Tesamorelin

Lyochem buyer fit

Overview

Tesamorelin is a 44-residue GHRH analog bearing an N-terminal trans-3-hexenoyl cap that shields it from DPP-4 proteolysis and prolongs plasma exposure relative to native GHRH or unmodified Sermorelin. Distinct within its class, it is the sole FDA-approved GHRH analog, marketed as the finished drug Egrifta for reducing excess visceral abdominal fat in HIV-associated lipodystrophy. Ask sales for the COA matched to the offered Tesamorelin acetate lot and review the identity and purity work actually recorded there. If a buyer's written procedure requires added ESI-MS, RP-HPLC, LC-MS/MS, or other evidence, define the method, acceptance rule, sample, report, timing, and cost before quotation; a new supplier alone does not make duplicate testing mandatory. The material is typically ordered either as a standalone vial or as the pre-blended Tesamorelin + Ipamorelin product.

Applications & buyer fit

Specifications

CAS

218949-48-5

Sequence

(trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Appearance

White to off-white lyophilized powder

Purity (HPLC)

≥ 99.0%

Strength

2 mg – 20 mg

Packaging

10 vials/box · base pack (multiples of 10)

Half-life

≈ 8 minutes

MOQ

On request

Lead time

10–18 days

Storage

Room temperature, protect from light

Documentation available on request

• Lot-specific Certificate of Analysis (CoA)
• RP-HPLC chromatogram with peak integration
• ESI-MS identity confirmation (±0.5 Da)
• Sequence verification by LC-MS/MS
• Water content by Karl Fischer
• SDS / MSDS
• Counter-ion analysis (acetate vs TFA)
• Stability at −20 °C across 12 months
• Solubility in BAC water / PBS reconstitution

Regulatory note

The finished Tesamorelin drug (Egrifta) is FDA-approved for HIV-associated lipodystrophy. Lyochem supplies the bulk active strictly for Research Use Only; buyers are responsible for verifying ingredient eligibility in their destination market.

Selected literature

1. Falutz J, Allas S, Blot K, et al. Metabolic effects of a growth hormone-releasing factor in patients with HIV. N Engl J Med. 2007;357(23):2359-2370.
2. Falutz J, Potvin D, Mamputu JC, et al. Effects of tesamorelin, a growth hormone-releasing factor, in HIV-infected patients with abdominal fat accumulation: a randomized placebo-controlled trial with a safety extension. J Acquir Immune Defic Syndr. 2010;53(3):311-322.
3. Stanley TL, Feldpausch MN, Oh J, et al. Effect of tesamorelin on visceral fat and liver fat in HIV-infected patients with abdominal fat accumulation: a randomized clinical trial. JAMA. 2014;312(4):380-389.
4. Stanley TL, Fourman LT, Feldpausch MN, et al. Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. Lancet HIV. 2019;6(12):e821-e830.
5. Baker LD, Barsness SM, Borson S, et al. Effects of growth hormone-releasing hormone on cognitive function in adults with mild cognitive impairment and healthy older adults: results of a controlled trial. Arch Neurol. 2012;69(11):1420-1429.
6. Badran AS, Helal A, Shata KS, Ayesh H. Body composition, hepatic fat, metabolic, and safety outcomes of Tesamorelin, a GHRH analogue, in HIV-associated lipodystrophy: a meta-analysis of randomized controlled trials. Obesity Research & Clinical Practice. 2026;20(1):2-12.

Frequently asked questions