If a supplied lot fails agreed specifications, we’ll replace it at no cost or refund its purchase price in full.
Quality test failed? Free replacement or full refund.
Off-spec? Free replacement or full refund.
Reading a Peptide HPLC Trace — A 5-Minute Field Guide for Bench Scientists. Read our briefing →
Reading a peptide HPLC trace — a field guide. Read →
On reading HPLC traces. Read →
Reference standard · Research use only
GLP-1 receptor agonist · 31-mer metabolic reference standard
Price, MOQ and lead time come in your written quote — usually within 24 hours. No account needed.
Compound facts
| Name | Liraglutide |
|---|---|
| CAS number | 204656-20-2 |
| PubChem CID | 16134956 |
| Molecular formula | C172H265N43O51 |
| Molecular weight | 3751.20 g/mol |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG |
| Appearance | White to off-white lyophilized powder |
| Purity specification (HPLC) | ≥ 99.0% |
| On every batch COA | RP-HPLC purity · ESI-MS identity · Bacterial endotoxin · Fill amount (content per vial) |
| On request | LC-MS/MS sequence confirmation · Net peptide content · Water content (Karl Fischer) · Counter-ion content (e.g. acetate, TFA) · Microbial limits |
| Storage | -20°C, protect from light |
| Strengths per vial | 5 mg · 10 mg · 20 mg · 30 mg |
| Pack | 10 vials per kit |
| MOQ | On request |
| Lead time | 10–18 days |
| Use | Research use only — not for human or veterinary use |
Identity data from the Lyochem product catalogue, checked against PubChem and registry records. The batch COA of your lot is the record for that lot's results. How to verify a COA
Lot documentation
Values belong to the lot. Ask for the COA of the offered lot before you order.
Independent test fails? Full refund. How it works
Overview
Liraglutide is a 31-amino-acid GLP-1 receptor agonist and the molecule that first established the fatty-acid-lipidation half-life strategy later carried through to Semaglutide and Tirzepatide. The structure pairs a C16 palmitoyl moiety, attached through a γ-glutamyl spacer at Lys26, with an Arg34-for-Lys34 substitution that blocks off-target acylation during synthesis; the C16 chain is the shorter end of the lipidation series the GLP-1 class is built on, which is why Liraglutide is a frequent comparator in incretin structure-activity studies. It is the active ingredient of approved finished drugs under separate brand names, but the material supplied here is a reference reagent only — characterized as a standard, not described for any therapeutic outcome. Lyochem supplies Liraglutide as an analytical reference standard, and every lot has its own batch COA: RP-HPLC purity (gradient method, UV 214 nm) and ESI-MS identity within 0.5 Da of the theoretical 3751.20 g/mol. Sequence confirmation by LC-MS/MS, counter-ion content and Karl Fischer water content are available on request and listed on the COA when tested. Because the 31-residue lipidated backbone sits at the more demanding end of routine SPPS, deletion sequences elute close to the target peak on RP-HPLC, so tandem-MS sequence verification is an available sequence-level add-on. Bacterial endotoxin (LAL) is an on-request add-on for in vivo metabolic-model work. Fills run mg-scale for reproducible aliquoting across a study series; this is reference-grade research material, distinct from compounding-scale API supply.
Applications & buyer fit
GLP-1 and metabolic-peptide buyers run incretin-pathway and related research. Ask sales for the COA matched to the offered or supplied lot. If the buyer's written procedure requires tandem-MS sequence evidence or other expanded methods, agree the analytical scope, timing, and cost before quotation.
Academic Laboratories
Universities, medical schools, and government research institutes qualifying a reference standard for a method-development or in vivo workflow.
Biotech R&D Groups
Preclinical biotech and pharmaceutical discovery teams sourcing characterized peptides for receptor-pharmacology, screening, and method-development campaigns.
Every lot has its own batch-specific CoA — RP-HPLC purity, ESI-MS identity, bacterial endotoxin and fill amount, plus any analytical scope agreed at quote stage — tied to the exact lot you receive.
Review a representative batch CoA before you order, so you can confirm the packet matches what your method or sponsor audit needs.
Supplied strictly as a research reagent to research institutions — not a finished dosage form and not for human administration. Buyer qualification runs at the inquiry stage.
Other formats
Liraglutide is also kept as a solution in nasal spray bottles.
| Contents | 5 mg |
|---|---|
| Fill volume | 10 mL or 20 mL |
| Minimum | 10 bottles per content and volume |
| Stock | Held in the United States, shipped within the US |
Regulatory note
Sold for Research Use Only under the receiving laboratory's institutional and jurisdictional regulations. Not a finished dosage form and not labelled for human administration. Liraglutide is the active ingredient of approved finished drugs under separate brand names, but the bulk active supplied here is a research reagent; buyers are responsible for institutional biosafety review and verifying import eligibility in the destination market.
Selected literature
Frequently asked questions
Liraglutide CAS is 204656-20-2; molecular formula C172H265N43O51; average molecular weight 3751.20 g/mol. It is a 31-amino-acid GLP-1 receptor agonist carrying a C16 palmitoyl group on Lys26 via a γ-glutamyl spacer, with an Arg34 substitution. Each Lyochem lot confirms identity by ESI-MS within 0.5 Da of the theoretical mass and reproduces the value on the batch COA so it can be cited directly in a methods section.
All three use fatty-acid conjugation to extend half-life, but with increasing chain length and linker complexity: Liraglutide (C16, single γGlu spacer), Semaglutide (C18 diacid, extended linker), Tirzepatide (C20 diacid). Liraglutide is the shortest-acting and earliest member, which makes it the baseline anchor when the class is studied as a structure-activity progression. Lyochem supplies each as an independently characterized lot so a lab can confirm every member against its own analytical packet before comparison.
Ask sales for the applicable batch COA first; include tandem-MS only when required by the buyer’s written analytical scope. The lipidation modification at Lys26 shifts the mass roughly +396 Da relative to unmodified GLP-1(7-37); if the dominant species sits at the unmodified mass, the acylation step has not gone to completion. The b/y-ion ladder from LC-MS/MS demonstrates the supplied sequence matches the labelled sequence, and endotoxin is included only when required by the buyer’s written protocol.
Yes: 5 mg, in 10 mL or 20 mL bottles, minimum 10 bottles per content and volume. This format is held in the United States and shipped within the US; contact sales for availability and a quotation.
Send any vial from your order to an independent laboratory of your choice. If the report shows the product does not meet the specification on its COA — purity below the stated minimum, or an identity that does not match — share the report with our sales team and we refund that product in full.
Related peptides
GLP-1 receptor agonist · 31-mer metabolic research peptide
Also in nasal spray
GIP / GLP-1 dual receptor agonist · 39-mer metabolic research peptide
Also in nasal spray