If a supplied lot fails agreed specifications, we’ll replace it at no cost or refund its purchase price in full.
Quality test failed? Free replacement or full refund.
Off-spec? Free replacement or full refund.
Reading a Peptide HPLC Trace — A 5-Minute Field Guide for Bench Scientists. Read our briefing →
Reading a peptide HPLC trace — a field guide. Read →
On reading HPLC traces. Read →
Reference standard · Research use only
Long-acting amylin analog · metabolic research peptide
Price, MOQ and lead time come in your written quote — usually within 24 hours. No account needed.
Compound facts
| Name | Cagrilintide |
|---|---|
| CAS number | 1415456-99-3 |
| PubChem CID | 171397054 |
| Molecular formula | C194H312N54O59S2 |
| Molecular weight | 4409 g/mol |
| Sequence | KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Appearance | White to off-white lyophilized powder |
| Purity specification (HPLC) | ≥ 99.0% |
| On every batch COA | RP-HPLC purity · ESI-MS identity · Bacterial endotoxin · Fill amount (content per vial) |
| On request | LC-MS/MS sequence confirmation · Net peptide content · Water content (Karl Fischer) · Counter-ion content (e.g. acetate, TFA) · Microbial limits |
| Storage | 2–8°C, protect from light |
| Strengths per vial | 2 mg · 5 mg · 10 mg |
| Pack | 10 vials per kit |
| MOQ | On request |
| Lead time | 14–21 days |
| Use | Research use only — not for human or veterinary use |
Identity data from the Lyochem product catalogue, checked against PubChem and registry records. The batch COA of your lot is the record for that lot's results. How to verify a COA
Lot documentation
Values belong to the lot. Ask for the COA of the offered lot before you order.
Independent test fails? Full refund. How it works
Overview
Cagrilintide is a long-acting synthetic analog of amylin, the pancreatic peptide hormone co-secreted with insulin that contributes to satiety and gastric-emptying regulation. It is most studied in combination with Semaglutide (the co-formulation referenced in the literature as CagriSema), where the amylin and GLP-1 pathways are investigated for additive metabolic effects. As an investigational compound it is not an approved finished drug; the material supplied here is a research reagent only. Lyochem supplies Cagrilintide as a lyophilized powder, and every lot has its own batch COA with RP-HPLC purity (gradient method, UV 214 nm) and ESI-MS for identity; sequence confirmation by LC-MS/MS, counter-ion content and Karl Fischer water content are available on request and listed on the COA when tested. Sequence verification by tandem MS is available when required by an agreed qualification protocol. For labs studying the amylin + GLP-1 combination, Lyochem supplies Cagrilintide and Semaglutide as separate characterized lots rather than a pre-mixed blend, so each can be confirmed against its own analytical packet before the buyer prepares the combination in-protocol. Fills run mg-scale; this is reference-grade research material, distinct from compounding-scale API supply.
Applications & buyer fit
GLP-1 and metabolic-peptide buyers run incretin-pathway and related research. Ask sales for the COA matched to the offered or supplied lot. If the buyer's written procedure requires tandem-MS sequence evidence or other expanded methods, agree the analytical scope, timing, and cost before quotation.
Academic Laboratories
Universities, medical schools, and government research institutes qualifying a reference standard for a method-development or in vivo workflow.
Biotech R&D Groups
Preclinical biotech and pharmaceutical discovery teams sourcing characterized peptides for receptor-pharmacology, screening, and method-development campaigns.
Every lot has its own batch-specific CoA — RP-HPLC purity, ESI-MS identity, bacterial endotoxin and fill amount, plus any analytical scope agreed at quote stage — tied to the exact lot you receive.
Review a representative batch CoA before you order, so you can confirm the packet matches what your method or sponsor audit needs.
Supplied strictly as a research reagent to research institutions — not a finished dosage form and not for human administration. Buyer qualification runs at the inquiry stage.
Other formats
Cagrilintide is also kept as a solution in nasal spray bottles.
| Contents | 2 mg, 5 mg, 10 mg |
|---|---|
| Fill volume | 10 mL or 20 mL |
| Minimum | 10 bottles per content and volume |
| Stock | Held in the United States, shipped within the US |
Regulatory note
Investigational compound; not approved as a finished drug in any jurisdiction. Sold for Research Use Only under the receiving laboratory's institutional and jurisdictional regulations — not a finished dosage form and not labelled for human administration. Buyers are responsible for institutional biosafety review and verifying import eligibility in the destination market.
Selected literature
Frequently asked questions
Cagrilintide is a long-acting synthetic analog of amylin, a pancreatic peptide co-secreted with insulin that contributes to satiety signalling and gastric-emptying regulation. The native hormone has a very short half-life; Cagrilintide is engineered for extended action, which is why it is used as the amylin-pathway reference in metabolic research. CAS is 1415456-99-3; identity is confirmed by ESI-MS against the theoretical mass for the supplied form on the applicable batch COA.
Cagrilintide (amylin pathway) and Semaglutide (GLP-1 pathway) act through distinct receptors, and the combination referenced in the literature as CagriSema is studied for additive metabolic effects beyond either pathway alone. The amylin arm contributes satiety and gastric-emptying effects that complement the incretin mechanism, which is the rationale for the combination being a frequent subject in incretin-plus-amylin pharmacology studies.
No. Lyochem supplies Cagrilintide and Semaglutide as separate characterized lots, each with its own analytical packet, rather than a pre-mixed blend. This lets a lab confirm the identity and purity of each component independently before preparing the combination in-protocol, which is the methodologically cleaner approach for research; a pre-mixed blend obscures the per-component analytical data that a citable methods section needs.
Yes: 2 mg, 5 mg, 10 mg, in 10 mL or 20 mL bottles, minimum 10 bottles per content and volume. This format is held in the United States and shipped within the US; contact sales for availability and a quotation.
Send any vial from your order to an independent laboratory of your choice. If the report shows the product does not meet the specification on its COA — purity below the stated minimum, or an identity that does not match — share the report with our sales team and we refund that product in full.
Related peptides
GLP-1 receptor agonist · 31-mer metabolic research peptide
Also in nasal spray
GIP / GLP-1 dual receptor agonist · 39-mer metabolic research peptide
Also in nasal spray